PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_3458_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 173aa    MW: 19754.4 Da    PI: 6.805
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_3458_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.44.8e-081121442254
                                          SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                             Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                           +yp++e++++L +++gL+ +q+ +WF N+R +
  cra_locus_3458_iso_5_len_1137_ver_3 112 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 144
                                          69*****************************87 PP

2ELK30.48.6e-116586122
                                  ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                                         ELKh+L+++Y+++++++++E++
  cra_locus_3458_iso_5_len_1137_ver_3 65 ELKHELKQGYKEKIVDIREEIL 86
                                         9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512139.9696585IPR005539ELK domain
SMARTSM011886.1E-46586IPR005539ELK domain
PfamPF037893.1E-76586IPR005539ELK domain
PROSITE profilePS5007111.67785148IPR001356Homeobox domain
SMARTSM003897.6E-1187152IPR001356Homeobox domain
SuperFamilySSF466891.45E-1687152IPR009057Homeodomain-like
CDDcd000861.17E-1088147No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2592149IPR009057Homeodomain-like
PfamPF059203.1E-18105144IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MXCXNWTGVA PSEGTGATMS DDDDDQADSD ANLFDGGLDA QDSMGFGPLT PTESERSLME  60
RVRQELKHEL KQGYKEKIVD IREEILRKRR AGKLPGDTTS LLKAWWQSHS KWPYPTEEDK  120
ARLVQETGLQ LKQINNWFIN QRKRNWHSNP SSSSSQKSKR KSAGEKSNNE QFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A6e-1488152872Homeobox protein PKNOX1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010648713.11e-103PREDICTED: homeobox protein knotted-1-like 3 isoform X1
RefseqXP_011084049.11e-103PREDICTED: homeobox protein knotted-1-like LET12 isoform X1
SwissprotP480002e-99KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLF6H3V21e-103F6H3V2_VITVI; Putative uncharacterized protein
STRINGVIT_04s0008g06130.t011e-102(Vitis vinifera)